PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00756.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 1532aa    MW: 172064 Da    PI: 6.2105
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00756.1_g00007.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.87.9e-4893010782128
                      NAM    2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk........................kvkaeekewyfF 61  
                               ppGfrFhPtdeelv +yLkkk+ +k++ l ++i+e+d+yk+eP+dLp                         k+k+++++w+fF
  Sme2.5_00756.1_g00007.1  930 PPGFRFHPTDEELVLYYLKKKICRKRILL-DAIAETDVYKWEPEDLPGtaldcftlgwflsetslplkwdlsKLKTGDRQWFFF 1012
                               9*************************999.99***************5589******************9999999******** PP

                      NAM   62 skrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 
                               s+rd+ky++g r+nratk+g Wk tg+d+++++ ++++vg+kktLvfykgrap g +tdWvmhey++
  Sme2.5_00756.1_g00007.1 1013 SPRDRKYPNGARANRATKQGHWKITGRDRTITC-NSRAVGVKKTLVFYKGRAPVGDRTDWVMHEYTM 1078
                               *********************************.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5099418.486290468IPR001584Integrase, catalytic core
Gene3DG3DSA:3.30.420.101.3E-23300461IPR012337Ribonuclease H-like domain
SuperFamilySSF530984.7E-36303468IPR012337Ribonuclease H-like domain
PfamPF006651.6E-18306419IPR001584Integrase, catalytic core
PfamPF077273.1E-37709848IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
SuperFamilySSF566723.51E-5717832No hitNo description
SuperFamilySSF1019414.45E-529241101IPR003441NAC domain
PROSITE profilePS5100551.2139291101IPR003441NAC domain
PfamPF023652.5E-259301077IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015074Biological ProcessDNA integration
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1532 aa     Download sequence    Send to blast
MGVGEDPSLL LYPLKISWAS LMEVASLQES IHQIFHYGTN HMTSGKILKT GSASPMGQNS  60
YHLQNELNDL VQETNDITGY YTKIKALWDE LDLLNAKNCC SCGCTCGGKI MSAKSLQDER  120
LIQFLMGLND AYSPARNNIL MIHPLPSISL AYSPIMQDEQ QREFANCSHF SGSSSSSLEL  180
SGFHQTSSLP DLRGYKGSSL KRPLTLGDVK EELYQLQASS QFSKKRVQHS ALSARTPSLV  240
SFSSFVVLKK DSDVRLWHHR LGHLPISGMK SFVFNSMPSC YCDVCLLARQ SKLPFPISEI  300
KTKSIFELIH VDTWGPYKSP TYNGFKYILI IVDDFSRATW TYLLKTKANA FFMLKIFLDV  360
VERQFNCQVK IIRSDNALKL GKNITTTEIF NSKGIIHQTS CVVTPQQNGV MERKHRHLLE  420
TSRSLFFQSS LPISYWGECV LTTTFLINRF PSRVLNGVIP YEILYGLPPT YTHLRSFECL  480
CYASTLSQSR TKFQPRALTC VFFGYPPGQK GYKLLILETK KIIISRDVKF IEYIFLFKAI  540
PISDSSTNPI FTAPLDQTFF SSQEPILPSH PSSLPSSQST NASPAVSPCP FPISPNSVIL  600
STPTVPPIRQ STRPHKKPVY LSDYVYNAVY LTKSCFASPT PSSVYPFAAF SLPSQQNLSS  660
TLNFVELIRF AQAALHPGWQ QAITSEFAAL EAKQDLGSSS FTGSIMKFPP RMVGPSPAHV  720
CKLTKSLYGL RKVSRQWYAK LTSALNYEGF ISSLNDYSLF VKKDGTSISI VVVYVDDIIL  780
TGNNSDELDQ VKSFMNEEFK IKDLGELHYF LGLEILREPH GMIVTQQKYT MELLSAYDCS  840
HLPLASSPLD PTVKLSTTSG EPLIDATSHR RPLSVSLFDD QSCSRSIFIS GFLSQIGCLL  900
RCRLSEEMKM LGLSDSDSFA GFASSKNVYP PGFRFHPTDE ELVLYYLKKK ICRKRILLDA  960
IAETDVYKWE PEDLPGTALD CFTLGWFLSE TSLPLKWDLS KLKTGDRQWF FFSPRDRKYP  1020
NGARANRATK QGHWKITGRD RTITCNSRAV GVKKTLVFYK GRAPVGDRTD WVMHEYTMHE  1080
EELGKCQNAQ DYYALYKVFK KSGSGPKNGE QYGAPFREEE WADDECPSVK GFIHQQDNST  1140
KHVNEAPAAD GGLEELLKHS ENEPVLVEPL PVDYDYALEQ LVHEEDTRSI LLDHSREINF  1200
PNHGAVIAPV KESFELMQSG TSQLQSHEAP EVTSVPVIFE PQLHVVEEDV FEDFLEIADL  1260
LSPEPSAQNF DNPELGVENF DEAGSSGQNF DKSAGNFEDL QFDYLDGLAE FDLYQTLLDD  1320
IRTTEVGQIT EPYMDNFVNG SVNPASTTYT STFQHEMMNN QPMYLNNEEL INNQLWTHDQ  1380
RFNVFNPSEA NQLVVPPATS DSNLSYLPMD ANQNQLSNQD DGTPSWLSSQ LWDFMDSIPT  1440
APAIAAEGPA INSAFKRMSS FSRMRINANM NVMAAGTFVE VLRRHISSDR LVAGWSYAKI  1500
SYAGNGKVGV HFIVLGSHLW DSAEYVAELL VV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-43930107816140Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0135490.0BT013549.1 Lycopersicon esculentum clone 132273F, mRNA sequence.
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32122451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-94NAC domain containing protein 17